![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
![]() | Protein automated matches [190119] (24 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries) |
![]() | Domain d3b9vb_: 3b9v B: [199084] automated match to d3b9vd_ |
PDB Entry: 3b9v (more details), 1.8 Å
SCOPe Domain Sequences for d3b9vb_:
Sequence, based on SEQRES records: (download)
>d3b9vb_ b.1.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} evqlvesggglvqpggslrlscaasgfnikdtyigwvrrapgkgeewvasiyptngytry adsvkgrftisadtskntaylqmnslraedtavyycarwggdgfyamdywgqgtlvtvs
>d3b9vb_ b.1.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} evqlvesggglvqpggslrlscaasgfnikdtyigwvrrapgkgeewvasiyptngytry adsvkgrftisadtskntaylqmnslraedtavyycarwggyamdywgqgtlvtvs
Timeline for d3b9vb_: