SCOPe 2.05: Domain d3b9ma3: 3b9m A:3-196

Lineage for d3b9ma3 (3b9m A:3-196)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.126: Serum albumin-like [48551] (1 superfamily)
   multihelical; one domain consists of two similar disulfide-linked subdomains

4. Superfamily a.126.1: Serum albumin-like [48552] (2 families)

5. Family a.126.1.1: Serum albumin-like [48553] (2 proteins)

6. Protein Serum albumin [48554] (1 species)
   duplication: consists of three domains of this fold

7. Species Human (Homo sapiens) [TaxId:9606] [48555] (70 PDB entries)
   Uniprot P02768 29-596

8. Domain d3b9ma3: 3b9m A:3-196 [199082]
   automated match to d1n5ua1
   complexed with azz, myr, sal

Details for d3b9ma3

PDB Entry: 3b9m, 2.7 Å

PDB Description: Human serum albumin complexed with myristate, 3'-azido-3'-deoxythymidine (AZT) and salicylic acid

PDB Compounds: (A:) serum albumin

SCOPe Domain Sequences for d3b9ma3:

Sequence; same for both SEQRES and ATOM records:

>d3b9ma3 a.126.1.1 (A:3-196) Serum albumin {Human (Homo sapiens) [TaxId: 9606]}
hksevahrfkdlgeenfkalvliafaqylqqcpfedhvklvnevtefaktcvadesaenc
dkslhtlfgdklctvatlretygemadccakqepernecflqhkddnpnlprlvrpevdv
mctafhdneetflkkylyeiarrhpyfyapellffakrykaafteccqaadkaacllpkl
delrdegkassakq

Timeline for d3b9ma3:

• d3b9ma3 first appeared in SCOPe 2.03
  
• d3b9ma3 appears in SCOPe 2.04
  
• d3b9ma3 appears in SCOPe 2.06
  
• d3b9ma3 appears in the current release, SCOPe 2.08