Class b: All beta proteins [48724] (119 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins) |
Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species) |
Species Fab 36-71 (mouse), kappa L chain [48779] (2 PDB entries) |
Domain d6fabl1: 6fab L:1-108 [19908] Other proteins in same PDB: d6fabh2, d6fabl2 |
PDB Entry: 6fab (more details), 1.9 Å
SCOP Domain Sequences for d6fabl1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6fabl1 b.1.1.1 (L:1-108) Immunoglobulin (variable domains of L and H chains) {Fab 36-71 (mouse), kappa L chain} diqmtqipsslsaslgdrvsiscrasqdinnflnwyqqkpdgtiklliyftsrsqsgvps rfsgsgsgtdysltisnleqediatyfcqqgnalprtfgggtkleikr
Timeline for d6fabl1: