![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
![]() | Protein automated matches [190740] (31 species) not a true protein |
![]() | Species Rat (Rattus rattus) [TaxId:10117] [225552] (1 PDB entry) |
![]() | Domain d3b9kc2: 3b9k C:108-214 [199078] Other proteins in same PDB: d3b9ka_, d3b9kb_, d3b9kc1, d3b9kd_, d3b9ke_, d3b9kf_, d3b9kh_, d3b9kl1 automated match to d1c5da2 complexed with nag |
PDB Entry: 3b9k (more details), 2.7 Å
SCOPe Domain Sequences for d3b9kc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3b9kc2 b.1.1.0 (C:108-214) automated matches {Rat (Rattus rattus) [TaxId: 10117]} radaaptvsifppsmeqltsggatvvcfvnnfyprdisvkwkidgseqrdgvldsvtdqd skdstysmsstlsltkveyerhnlytcevvhktssspvvksfnrgec
Timeline for d3b9kc2: