SCOP 1.63: Domain d4fabh1: 4fab H:1-118

Lineage for d4fabh1 (4fab H:1-118)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)

7. Species Fab 4-4-20 (mouse), kappa L chain [48778] (2 PDB entries)

8. Domain d4fabh1: 4fab H:1-118 [19907]
   Other proteins in same PDB: d4fabh2, d4fabl2
   complexed with fds, mpd

Details for d4fabh1

PDB Entry: 4fab, 2.7 Å

PDB Description: three-dimensional structure of a fluorescein-fab complex crystallized in 2-methyl-2,4-pentanediol

SCOP Domain Sequences for d4fabh1:

Sequence; same for both SEQRES and ATOM records:

>d4fabh1 b.1.1.1 (H:1-118) Immunoglobulin (variable domains of L and H chains) {Fab 4-4-20 (mouse), kappa L chain}
evkldetggglvqpgrpmklscvasgftfsdywmnwvrqspekglewvaqirnkpynyet
yysdsvkgrftisrddskssvylqmnnlrvedmgiyyctgsyygmdywgqgtsvtvss

Timeline for d4fabh1:

• d4fabh1 first appeared (with stable ids) in SCOP 1.55
  
• d4fabh1 appears in SCOP 1.61
  
• d4fabh1 appears in SCOP 1.65
  
• d4fabh1 appears in the current release, SCOPe 2.08