Lineage for d4fabl1 (4fab L:1-112)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 51642Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 51698Protein Immunoglobulin (variable domains of L and H chains) [48749] (195 species)
  7. 52078Species Fab 4-4-20 (mouse), kappa L chain [48778] (2 PDB entries)
  8. 52082Domain d4fabl1: 4fab L:1-112 [19906]
    Other proteins in same PDB: d4fabh2, d4fabl2

Details for d4fabl1

PDB Entry: 4fab (more details), 2.7 Å

PDB Description: three-dimensional structure of a fluorescein-fab complex crystallized in 2-methyl-2,4-pentanediol

SCOP Domain Sequences for d4fabl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4fabl1 b.1.1.1 (L:1-112) Immunoglobulin (variable domains of L and H chains) {Fab 4-4-20 (mouse), kappa L chain}
dvvmtqtplslpvslgdqasiscrssqslvhsqgntylrwylqkpgqspkvliykvsnrf
sgvpdrfsgsgsgtdftlkisrveaedlgvyfcsqsthvpwtfgggtkleik

SCOP Domain Coordinates for d4fabl1:

Click to download the PDB-style file with coordinates for d4fabl1.
(The format of our PDB-style files is described here.)

Timeline for d4fabl1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4fabl2