SCOPe 2.08: Domain d3b82e5: 3b82 E:726-842

Lineage for d3b82e5 (3b82 E:726-842)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.11: EF-G C-terminal domain-like [54980] (4 families)

5. Family d.58.11.1: EF-G/eEF-2 domains III and V [54981] (5 proteins)
   domain III structure is lacking some of the superfamily characters and is often disordered in crystals

6. Protein Elongation factor 2 (eEF-2), C-terminal domain [419043] (2 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [419528] (13 PDB entries)
   Uniprot P32324

8. Domain d3b82e5: 3b82 E:726-842 [199059]
   Other proteins in same PDB: d3b82a1, d3b82a2, d3b82a3, d3b82a4, d3b82b1, d3b82b2, d3b82c1, d3b82c2, d3b82c3, d3b82c4, d3b82d1, d3b82d2, d3b82e1, d3b82e2, d3b82e3, d3b82e4, d3b82f1, d3b82f2
   automated match to d1n0vc5
   protein/RNA complex; complexed with nad
   has additional insertions and/or extensions that are not grouped together

Details for d3b82e5

PDB Entry: 3b82, 2.35 Å

PDB Description: structure of the eef2-exoa(e546h)-nad+ complex

PDB Compounds: (E:) Elongation factor 2

SCOPe Domain Sequences for d3b82e5:

Sequence; same for both SEQRES and ATOM records:

>d3b82e5 d.58.11.1 (E:726-842) Elongation factor 2 (eEF-2), C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
epvflveiqcpeqavggiysvlnkkrgqvvseeqrpgtplftvkaylpvnesfgftgelr
qatggqafpqmvfdhwstlgsdpldptskageivlaarkrhgmkeevpgwqeyydkl

Timeline for d3b82e5:

• d3b82e5 first appeared in SCOPe 2.03
  
• d3b82e5 appears in SCOPe 2.07