Lineage for d3b82e4 (3b82 E:561-725)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2930059Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 2930060Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. 2930061Family d.14.1.1: Translational machinery components [54212] (5 proteins)
  6. 2930062Protein Elongation factor 2 (eEF-2), domain IV [82575] (2 species)
  7. 2930063Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82576] (13 PDB entries)
    Uniprot P32324
  8. 2930066Domain d3b82e4: 3b82 E:561-725 [199058]
    Other proteins in same PDB: d3b82a1, d3b82a2, d3b82a3, d3b82a5, d3b82b1, d3b82b2, d3b82c1, d3b82c2, d3b82c3, d3b82c5, d3b82d1, d3b82d2, d3b82e1, d3b82e2, d3b82e3, d3b82e5, d3b82f1, d3b82f2
    automated match to d1n0vc3
    protein/RNA complex; complexed with nad

    has additional insertions and/or extensions that are not grouped together

Details for d3b82e4

PDB Entry: 3b82 (more details), 2.35 Å

PDB Description: structure of the eef2-exoa(e546h)-nad+ complex
PDB Compounds: (E:) Elongation factor 2

SCOPe Domain Sequences for d3b82e4:

Sequence; same for both SEQRES and ATOM records: (download)

>d3b82e4 d.14.1.1 (E:561-725) Elongation factor 2 (eEF-2), domain IV {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
vayretvesessqtalskspnkhnriylkaepideevslaiengiinprddfkararima
ddygwdvtdarkiwcfgpdgngpnlvidqtkavqylheikdsvvaafqwatkegpifgee
mrsvrvnildvtlhadaihrgggqiiptmrratyagflladpkiq

SCOPe Domain Coordinates for d3b82e4:

Click to download the PDB-style file with coordinates for d3b82e4.
(The format of our PDB-style files is described here.)

Timeline for d3b82e4: