Lineage for d1flrh1 (1flr H:1-118)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 218899Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)
  6. 218958Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)
  7. 219475Species Fab 4-4-20 (mouse), kappa L chain [48778] (2 PDB entries)
  8. 219476Domain d1flrh1: 1flr H:1-118 [19905]
    Other proteins in same PDB: d1flrh2, d1flrl2
    complexed with flu

Details for d1flrh1

PDB Entry: 1flr (more details), 1.85 Å

PDB Description: 4-4-20 fab fragment

SCOP Domain Sequences for d1flrh1:

Sequence, based on SEQRES records: (download)

>d1flrh1 b.1.1.1 (H:1-118) Immunoglobulin (variable domains of L and H chains) {Fab 4-4-20 (mouse), kappa L chain}
evkldetggglvqpgrpmklscvasgftfsdywmnwvrqspekglewvaqirnkpynyet
yysdsvkgrftisrddskssvylqmnnlrvedmgiyyctgsyygmdywgqgtsvtvss

Sequence, based on observed residues (ATOM records): (download)

>d1flrh1 b.1.1.1 (H:1-118) Immunoglobulin (variable domains of L and H chains) {Fab 4-4-20 (mouse), kappa L chain}
evkldetggglvqpgrpmklscvasgftfsdywmnwvrqspekglewvaqirnkpynyet
yysdsvkgrftisrddssvylqmnnlrvedmgiyyctgsyygmdywgqgtsvtvss

SCOP Domain Coordinates for d1flrh1:

Click to download the PDB-style file with coordinates for d1flrh1.
(The format of our PDB-style files is described here.)

Timeline for d1flrh1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1flrh2