Lineage for d1flrh1 (1flr H:1-118)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2017117Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 protein domains)
  6. 2017323Protein Immunoglobulin heavy chain variable domain, VH [88543] (21 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 2017580Species Mouse (Mus musculus), cluster 1 [TaxId:10090] [88548] (68 PDB entries)
    Uniprot P01796 # ! HV27_MOUSE Ig heavy chain V-III region A4
  8. 2017612Domain d1flrh1: 1flr H:1-118 [19905]
    Other proteins in same PDB: d1flrh2, d1flrl1, d1flrl2
    part of Fab 4-4-20
    complexed with flu

Details for d1flrh1

PDB Entry: 1flr (more details), 1.85 Å

PDB Description: 4-4-20 fab fragment
PDB Compounds: (H:) 4-4-20 (ig*g2a=kappa=) fab fragment

SCOPe Domain Sequences for d1flrh1:

Sequence, based on SEQRES records: (download)

>d1flrh1 b.1.1.1 (H:1-118) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 1 [TaxId: 10090]}
evkldetggglvqpgrpmklscvasgftfsdywmnwvrqspekglewvaqirnkpynyet
yysdsvkgrftisrddskssvylqmnnlrvedmgiyyctgsyygmdywgqgtsvtvss

Sequence, based on observed residues (ATOM records): (download)

>d1flrh1 b.1.1.1 (H:1-118) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 1 [TaxId: 10090]}
evkldetggglvqpgrpmklscvasgftfsdywmnwvrqspekglewvaqirnkpynyet
yysdsvkgrftisrddssvylqmnnlrvedmgiyyctgsyygmdywgqgtsvtvss

SCOPe Domain Coordinates for d1flrh1:

Click to download the PDB-style file with coordinates for d1flrh1.
(The format of our PDB-style files is described here.)

Timeline for d1flrh1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1flrh2