Lineage for d3b78c4 (3b78 C:561-725)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1636635Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 1636636Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. 1636637Family d.14.1.1: Translational machinery components [54212] (4 proteins)
  6. 1636638Protein Elongation factor 2 (eEF-2), domain IV [82575] (1 species)
  7. 1636639Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82576] (13 PDB entries)
    Uniprot P32324
  8. 1636645Domain d3b78c4: 3b78 C:561-725 [199038]
    Other proteins in same PDB: d3b78a1, d3b78a2, d3b78a3, d3b78a5, d3b78b_, d3b78c1, d3b78c2, d3b78c3, d3b78c5, d3b78d_, d3b78e1, d3b78e2, d3b78e3, d3b78e5, d3b78f_
    automated match to d1n0vc3
    protein/RNA complex; complexed with nad

Details for d3b78c4

PDB Entry: 3b78 (more details), 2.5 Å

PDB Description: structure of the eef2-exoa(r551h)-nad+ complex
PDB Compounds: (C:) Elongation factor 2

SCOPe Domain Sequences for d3b78c4:

Sequence; same for both SEQRES and ATOM records: (download)

>d3b78c4 d.14.1.1 (C:561-725) Elongation factor 2 (eEF-2), domain IV {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
vayretvesessqtalskspnkhnriylkaepideevslaiengiinprddfkararima
ddygwdvtdarkiwcfgpdgngpnlvidqtkavqylheikdsvvaafqwatkegpifgee
mrsvrvnildvtlhadaihrgggqiiptmrratyagflladpkiq

SCOPe Domain Coordinates for d3b78c4:

Click to download the PDB-style file with coordinates for d3b78c4.
(The format of our PDB-style files is described here.)

Timeline for d3b78c4: