Lineage for d3b78a4 (3b78 A:561-725)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1401399Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 1401400Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. 1401401Family d.14.1.1: Translational machinery components [54212] (4 proteins)
  6. 1401402Protein Elongation factor 2 (eEF-2), domain IV [82575] (1 species)
  7. 1401403Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82576] (16 PDB entries)
    Uniprot P32324
  8. 1401408Domain d3b78a4: 3b78 A:561-725 [199033]
    Other proteins in same PDB: d3b78a1, d3b78a2, d3b78a3, d3b78a5, d3b78b_, d3b78c1, d3b78c2, d3b78c3, d3b78c5, d3b78d_, d3b78e1, d3b78e2, d3b78e3, d3b78e5, d3b78f_
    automated match to d1n0vc3
    protein/RNA complex; complexed with nad

Details for d3b78a4

PDB Entry: 3b78 (more details), 2.5 Å

PDB Description: structure of the eef2-exoa(r551h)-nad+ complex
PDB Compounds: (A:) Elongation factor 2

SCOPe Domain Sequences for d3b78a4:

Sequence; same for both SEQRES and ATOM records: (download)

>d3b78a4 d.14.1.1 (A:561-725) Elongation factor 2 (eEF-2), domain IV {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
vayretvesessqtalskspnkhnriylkaepideevslaiengiinprddfkararima
ddygwdvtdarkiwcfgpdgngpnlvidqtkavqylheikdsvvaafqwatkegpifgee
mrsvrvnildvtlhadaihrgggqiiptmrratyagflladpkiq

SCOPe Domain Coordinates for d3b78a4:

Click to download the PDB-style file with coordinates for d3b78a4.
(The format of our PDB-style files is described here.)

Timeline for d3b78a4: