![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) ![]() |
![]() | Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins) |
![]() | Protein Nucleoside diphosphate kinase, NDK [54921] (23 species) |
![]() | Species Acanthamoeba polyphaga mimivirus [TaxId:212035] [224931] (1 PDB entry) |
![]() | Domain d3b6be1: 3b6b E:2-130 [199029] Other proteins in same PDB: d3b6ba2, d3b6bb2, d3b6bc2, d3b6bd2, d3b6be2, d3b6bf2 automated match to d3b6bf_ complexed with dgi, mg |
PDB Entry: 3b6b (more details), 2 Å
SCOPe Domain Sequences for d3b6be1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3b6be1 d.58.6.1 (E:2-130) Nucleoside diphosphate kinase, NDK {Acanthamoeba polyphaga mimivirus [TaxId: 212035]} qrtlvlikpdaferslvaeimgriekknfkivsmkfwskaprnlieqhykehseqsyfnd ncdfmvsgpiisivyegtdaiskirrlqgniltpgtirgdlandirenlihasdsedsav deisiwfpe
Timeline for d3b6be1: