Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) |
Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins) |
Protein Nucleoside diphosphate kinase, NDK [54921] (23 species) |
Species Acanthamoeba polyphaga mimivirus [TaxId:212035] [224931] (1 PDB entry) |
Domain d3b6bc_: 3b6b C: [199027] automated match to d3b6bf_ complexed with dgi, mg |
PDB Entry: 3b6b (more details), 2 Å
SCOPe Domain Sequences for d3b6bc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3b6bc_ d.58.6.1 (C:) Nucleoside diphosphate kinase, NDK {Acanthamoeba polyphaga mimivirus [TaxId: 212035]} glqrtlvlikpdaferslvaeimgriekknfkivsmkfwskaprnlieqhykehseqsyf ndncdfmvsgpiisivyegtdaiskirrlqgniltpgtirgdlandirenlihasdseds avdeisiwfpet
Timeline for d3b6bc_: