SCOPe 2.04: Domain d3b6bc_: 3b6b C:

Lineage for d3b6bc_ (3b6b C:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families)

5. Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins)

6. Protein Nucleoside diphosphate kinase, NDK [54921] (23 species)

7. Species Acanthamoeba polyphaga mimivirus [TaxId:212035] [224931] (1 PDB entry)

8. Domain d3b6bc_: 3b6b C: [199027]
   automated match to d3b6bf_
   complexed with dgi, mg

Details for d3b6bc_

PDB Entry: 3b6b, 2 Å

PDB Description: Crystal structure of Acanthamoeba polyphaga mimivirus nucleoside diphosphate kinase complexed with dGDP

PDB Compounds: (C:) Nucleoside diphosphate kinase

SCOPe Domain Sequences for d3b6bc_:

Sequence; same for both SEQRES and ATOM records:

>d3b6bc_ d.58.6.1 (C:) Nucleoside diphosphate kinase, NDK {Acanthamoeba polyphaga mimivirus [TaxId: 212035]}
glqrtlvlikpdaferslvaeimgriekknfkivsmkfwskaprnlieqhykehseqsyf
ndncdfmvsgpiisivyegtdaiskirrlqgniltpgtirgdlandirenlihasdseds
avdeisiwfpet

Timeline for d3b6bc_:

• d3b6bc_ first appeared in SCOPe 2.03
  
• d3b6bc_ appears in SCOPe 2.05
  
• d3b6bc_ appears in the current release, SCOPe 2.08, called d3b6bc1