Lineage for d3b2uk2 (3b2u K:108-213)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1764871Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1764872Protein automated matches [190740] (26 species)
    not a true protein
  7. 1765207Species Human (Homo sapiens) [TaxId:9606] [187920] (558 PDB entries)
  8. 1766007Domain d3b2uk2: 3b2u K:108-213 [199014]
    Other proteins in same PDB: d3b2ua1, d3b2ua2, d3b2ub1, d3b2ub2, d3b2uc1, d3b2uc2, d3b2ue1, d3b2ue2, d3b2uf1, d3b2uf2, d3b2uh1, d3b2uh2, d3b2ui1, d3b2ui2, d3b2uj1, d3b2uj2, d3b2um1, d3b2um2, d3b2un1, d3b2un2, d3b2up1, d3b2up2, d3b2uq1, d3b2uq2, d3b2us1, d3b2us2, d3b2ut1, d3b2ut2, d3b2uv1, d3b2uv2, d3b2uw1, d3b2uw2
    automated match to d1f3dj2
    complexed with nag, so4

Details for d3b2uk2

PDB Entry: 3b2u (more details), 2.58 Å

PDB Description: crystal structure of isolated domain iii of the extracellular region of the epidermal growth factor receptor in complex with the fab fragment of imc-11f8
PDB Compounds: (K:) IMC-11F8 FAB Light chain

SCOPe Domain Sequences for d3b2uk2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3b2uk2 b.1.1.0 (K:108-213) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrga

SCOPe Domain Coordinates for d3b2uk2:

Click to download the PDB-style file with coordinates for d3b2uk2.
(The format of our PDB-style files is described here.)

Timeline for d3b2uk2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3b2uk1
View in 3D
Domains from other chains:
(mouse over for more information)
d3b2ua1, d3b2ua2, d3b2ub1, d3b2ub2, d3b2uc1, d3b2uc2, d3b2ud1, d3b2ud2, d3b2ue1, d3b2ue2, d3b2uf1, d3b2uf2, d3b2ug1, d3b2ug2, d3b2uh1, d3b2uh2, d3b2ui1, d3b2ui2, d3b2uj1, d3b2uj2, d3b2ul1, d3b2ul2, d3b2um1, d3b2um2, d3b2un1, d3b2un2, d3b2uo1, d3b2uo2, d3b2up1, d3b2up2, d3b2uq1, d3b2uq2, d3b2ur1, d3b2ur2, d3b2us1, d3b2us2, d3b2ut1, d3b2ut2, d3b2uu1, d3b2uu2, d3b2uv1, d3b2uv2, d3b2uw1, d3b2uw2, d3b2ux1, d3b2ux2