![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
![]() | Protein automated matches [190740] (23 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187920] (336 PDB entries) |
![]() | Domain d3b2ug1: 3b2u G:1-107 [199011] Other proteins in same PDB: d3b2ua1, d3b2ua2, d3b2ub1, d3b2ub2, d3b2uc1, d3b2uc2, d3b2ue1, d3b2ue2, d3b2uf1, d3b2uf2, d3b2uh1, d3b2uh2, d3b2ui1, d3b2ui2, d3b2uj1, d3b2uj2, d3b2um1, d3b2um2, d3b2un1, d3b2un2, d3b2up1, d3b2up2, d3b2uq1, d3b2uq2, d3b2us1, d3b2us2, d3b2ut1, d3b2ut2, d3b2uv1, d3b2uv2, d3b2uw1, d3b2uw2 automated match to d1f3dj1 complexed with nag, so4 |
PDB Entry: 3b2u (more details), 2.58 Å
SCOPe Domain Sequences for d3b2ug1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3b2ug1 b.1.1.0 (G:1-107) automated matches {Human (Homo sapiens) [TaxId: 9606]} eivmtqspatlslspgeratlscrasqsvssylawyqqkpgqaprlliydasnratgipa rfsgsgsgtdftltisslepedfavyychqygstpltfgggtkaeik
Timeline for d3b2ug1:
![]() Domains from other chains: (mouse over for more information) d3b2ua1, d3b2ua2, d3b2ub1, d3b2ub2, d3b2uc1, d3b2uc2, d3b2ud1, d3b2ud2, d3b2ue1, d3b2ue2, d3b2uf1, d3b2uf2, d3b2uh1, d3b2uh2, d3b2ui1, d3b2ui2, d3b2uj1, d3b2uj2, d3b2uk1, d3b2uk2, d3b2ul1, d3b2ul2, d3b2um1, d3b2um2, d3b2un1, d3b2un2, d3b2uo1, d3b2uo2, d3b2up1, d3b2up2, d3b2uq1, d3b2uq2, d3b2ur1, d3b2ur2, d3b2us1, d3b2us2, d3b2ut1, d3b2ut2, d3b2uu1, d3b2uu2, d3b2uv1, d3b2uv2, d3b2uw1, d3b2uw2, d3b2ux1, d3b2ux2 |