Lineage for d1cbvh1 (1cbv H:1-122)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 218899Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)
  6. 218958Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)
  7. 219594Species Fab BV04-01 (mouse), kappa L chain [48776] (2 PDB entries)
  8. 219597Domain d1cbvh1: 1cbv H:1-122 [19901]
    Other proteins in same PDB: d1cbvh2, d1cbvl2

Details for d1cbvh1

PDB Entry: 1cbv (more details), 2.66 Å

PDB Description: an autoantibody to single-stranded dna: comparison of the three- dimensional structures of the unliganded fab and a deoxynucleotide- fab complex

SCOP Domain Sequences for d1cbvh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cbvh1 b.1.1.1 (H:1-122) Immunoglobulin (variable domains of L and H chains) {Fab BV04-01 (mouse), kappa L chain}
evqpvetggglvqpkgslklscaasgfsfntnamnwvrqapgkglewvarirsksnnyat
yyadsvkdrftisrddsqnmlylqmnnlktedtamyycvrdqtgtawfaywgqgtlvtvs
aa

SCOP Domain Coordinates for d1cbvh1:

Click to download the PDB-style file with coordinates for d1cbvh1.
(The format of our PDB-style files is described here.)

Timeline for d1cbvh1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1cbvh2