SCOP 1.63: Domain d1cbvh1: 1cbv H:1-122

Lineage for d1cbvh1 (1cbv H:1-122)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)

7. Species Fab BV04-01 (mouse), kappa L chain [48776] (2 PDB entries)

8. Domain d1cbvh1: 1cbv H:1-122 [19901]
   Other proteins in same PDB: d1cbvh2, d1cbvl2

Details for d1cbvh1

PDB Entry: 1cbv, 2.66 Å

PDB Description: an autoantibody to single-stranded dna: comparison of the three- dimensional structures of the unliganded fab and a deoxynucleotide- fab complex

SCOP Domain Sequences for d1cbvh1:

Sequence; same for both SEQRES and ATOM records:

>d1cbvh1 b.1.1.1 (H:1-122) Immunoglobulin (variable domains of L and H chains) {Fab BV04-01 (mouse), kappa L chain}
evqpvetggglvqpkgslklscaasgfsfntnamnwvrqapgkglewvarirsksnnyat
yyadsvkdrftisrddsqnmlylqmnnlktedtamyycvrdqtgtawfaywgqgtlvtvs
aa

Timeline for d1cbvh1:

• d1cbvh1 first appeared (with stable ids) in SCOP 1.55
  
• d1cbvh1 appears in SCOP 1.61
  
• d1cbvh1 appears in SCOP 1.65
  
• d1cbvh1 appears in the current release, SCOPe 2.08