Class b: All beta proteins [48724] (104 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins) |
Protein Immunoglobulin (variable domains of L and H chains) [48749] (195 species) |
Species Fab BV04-01 (mouse), kappa L chain [48776] (2 PDB entries) |
Domain d1cbvh1: 1cbv H:1-122 [19901] Other proteins in same PDB: d1cbvh2, d1cbvl2 |
PDB Entry: 1cbv (more details), 2.66 Å
SCOP Domain Sequences for d1cbvh1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cbvh1 b.1.1.1 (H:1-122) Immunoglobulin (variable domains of L and H chains) {Fab BV04-01 (mouse), kappa L chain} evqpvetggglvqpkgslklscaasgfsfntnamnwvrqapgkglewvarirsksnnyat yyadsvkdrftisrddsqnmlylqmnnlktedtamyycvrdqtgtawfaywgqgtlvtvs aa
Timeline for d1cbvh1: