SCOPe 2.06: Domain d3b1rd_: 3b1r D:

Lineage for d3b1rd_ (3b1r D:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.72: Ribokinase-like [53612] (3 superfamilies)
   core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
   potential superfamily: members of this fold have similar functions but different ATP-binding sites

4. Superfamily c.72.1: Ribokinase-like [53613] (6 families)
   has extra strand located between strands 2 and 3

5. Family c.72.1.0: automated matches [191321] (1 protein)
   not a true family

6. Protein automated matches [190117] (40 species)
   not a true protein

7. Species Burkholderia thailandensis [TaxId:271848] [196112] (5 PDB entries)

8. Domain d3b1rd_: 3b1r D: [199006]
   automated match to d3b1rc_
   complexed with amp, mg

Details for d3b1rd_

PDB Entry: 3b1r, 2 Å

PDB Description: Structure of Burkholderia thailandensis nucleoside kinase (BthNK) in complex with AMP-Mg-AMP

PDB Compounds: (D:) Ribokinase, putative

SCOPe Domain Sequences for d3b1rd_:

Sequence; same for both SEQRES and ATOM records:

>d3b1rd_ c.72.1.0 (D:) automated matches {Burkholderia thailandensis [TaxId: 271848]}
atlicgsiaydnimtfegrfrehilpdqvhlinlsflvptmrrefggcagniayalnllg
gdarmmgtlgavdaqpyldrmdalglsreyvrvlpdtysaqamittdldnnqitafhpga
mmqshvnhageakdiklaivgpdgfqgmvqhteelaqagvpfifdpgqglplfdgatlrr
sielatyiavndyeaklvcdktgwsedeiasrvqaliitrgehgatirhrdgteqipavr
aervidptgcgdafrggllygiehgfdwatagrlaslmgalkiahqgpqtyaptraeida
rfetafgyrp

Timeline for d3b1rd_:

• d3b1rd_ first appeared in SCOPe 2.03
  
• d3b1rd_ appears in SCOPe 2.05
  
• d3b1rd_ appears in SCOPe 2.07
  
• d3b1rd_ appears in the current release, SCOPe 2.08