Lineage for d3b1ca_ (3b1c A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2895166Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2895167Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2896671Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2896672Protein automated matches [190151] (166 species)
    not a true protein
  7. 2897988Species Streptococcus anginosus [TaxId:1328] [195061] (3 PDB entries)
  8. 2897989Domain d3b1ca_: 3b1c A: [199004]
    automated match to d3b1cc_
    complexed with gol, plp, so4

Details for d3b1ca_

PDB Entry: 3b1c (more details), 1.93 Å

PDB Description: Crystal structure of betaC-S lyase from Streptococcus anginosus: Internal aldimine form
PDB Compounds: (A:) BetaC-S lyase

SCOPe Domain Sequences for d3b1ca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3b1ca_ c.67.1.0 (A:) automated matches {Streptococcus anginosus [TaxId: 1328]}
skynfqtapnrlshhtykwketetdpqllpawiadmdfevmpevkqaihdyaeqlvygyt
yasdellqavldweksehqysfdkedivfvegvvpaisiaiqaftkegeavlinspvypp
farsvrlnnrklvsnslkeenglfqidfeqlendivendvklyllcnphnpggrvwerev
leqighlcqkhhvilvsdeihqdltlfghehvsfntvspdfkdfalvlssatktfniagt
knsyaiienptlcaqfkhqqlvnnhhevsslgyiatetayrygkpwlvalkavleeniqf
aveyfaqeaprlkvmkpqgtyliwldfsdygltddalftllhdqakvilnrgsdygsege
lharlniaapkslveeickrivcclpk

SCOPe Domain Coordinates for d3b1ca_:

Click to download the PDB-style file with coordinates for d3b1ca_.
(The format of our PDB-style files is described here.)

Timeline for d3b1ca_: