Lineage for d3azme_ (3azm E:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2311419Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 2311420Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. 2311421Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
    form octamers composed of two copies of each of the four histones
  6. 2311654Protein Histone H3 [47122] (6 species)
  7. 2311753Species Human (Homo sapiens) [TaxId:9606] [187038] (13 PDB entries)
  8. 2311773Domain d3azme_: 3azm E: [198998]
    Other proteins in same PDB: d3azma_, d3azmb_, d3azmc_, d3azmd_, d3azmf_, d3azmg_, d3azmh_
    automated match to d3afae_
    protein/DNA complex; complexed with cl, mn; mutant

Details for d3azme_

PDB Entry: 3azm (more details), 2.89 Å

PDB Description: Crystal Structure of Human Nucleosome Core Particle Containing H4K79Q mutation
PDB Compounds: (E:) Histone H3.1

SCOPe Domain Sequences for d3azme_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3azme_ a.22.1.1 (E:) Histone H3 {Human (Homo sapiens) [TaxId: 9606]}
kphryrpgtvalreirryqkstellirklpfqrlvreiaqdfktdlrfqssavmalqeac
eaylvglfedtnlcaihakrvtimpkdiqlarrirgera

SCOPe Domain Coordinates for d3azme_:

Click to download the PDB-style file with coordinates for d3azme_.
(The format of our PDB-style files is described here.)

Timeline for d3azme_: