Lineage for d3azmb_ (3azm B:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1262429Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 1262430Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. 1262431Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
    form octamers composed of two copies of each of the four histones
  6. 1262870Protein automated matches [193445] (4 species)
    not a true protein
  7. 1262881Species Human (Homo sapiens) [TaxId:9606] [193446] (18 PDB entries)
  8. 1262910Domain d3azmb_: 3azm B: [198997]
    Other proteins in same PDB: d3azme_
    automated match to d1s32f_
    protein/DNA complex; complexed with cl, mn; mutant

Details for d3azmb_

PDB Entry: 3azm (more details), 2.89 Å

PDB Description: Crystal Structure of Human Nucleosome Core Particle Containing H4K79Q mutation
PDB Compounds: (B:) histone h4

SCOPe Domain Sequences for d3azmb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3azmb_ a.22.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
niqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehakrqtvtam
dvvyalkrqgrtlygfg

SCOPe Domain Coordinates for d3azmb_:

Click to download the PDB-style file with coordinates for d3azmb_.
(The format of our PDB-style files is described here.)

Timeline for d3azmb_: