| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
Superfamily a.22.1: Histone-fold [47113] (5 families) ![]() |
| Family a.22.1.1: Nucleosome core histones [47114] (6 proteins) form octamers composed of two copies of each of the four histones |
| Protein Histone H3 [47122] (6 species) |
| Species Human (Homo sapiens) [TaxId:9606] [187038] (23 PDB entries) |
| Domain d3azla_: 3azl A: [198994] Other proteins in same PDB: d3azlb_, d3azlc_, d3azld_, d3azle_, d3azlf_, d3azlg_, d3azlh_ automated match to d3afaa_ protein/DNA complex; complexed with cl, mn; mutant |
PDB Entry: 3azl (more details), 2.7 Å
SCOPe Domain Sequences for d3azla_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3azla_ a.22.1.1 (A:) Histone H3 {Human (Homo sapiens) [TaxId: 9606]}
phryrpgtvalreirryqkstellirklpfqrlvreiaqdfktdlrfqssavmalqeace
aylvglfedtnlcaihakrvtimpkdiqlarrirger
Timeline for d3azla_: