Lineage for d3azla_ (3azl A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2698054Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 2698055Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. 2698056Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
    form octamers composed of two copies of each of the four histones
  6. 2698296Protein Histone H3 [47122] (6 species)
  7. 2698397Species Human (Homo sapiens) [TaxId:9606] [187038] (23 PDB entries)
  8. 2698402Domain d3azla_: 3azl A: [198994]
    Other proteins in same PDB: d3azlb_, d3azlc_, d3azld_, d3azle_, d3azlf_, d3azlg_, d3azlh_
    automated match to d3afaa_
    protein/DNA complex; complexed with cl, mn; mutant

Details for d3azla_

PDB Entry: 3azl (more details), 2.7 Å

PDB Description: Crystal Structure of Human Nucleosome Core Particle Containing H4K77Q mutation
PDB Compounds: (A:) Histone H3.1

SCOPe Domain Sequences for d3azla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3azla_ a.22.1.1 (A:) Histone H3 {Human (Homo sapiens) [TaxId: 9606]}
phryrpgtvalreirryqkstellirklpfqrlvreiaqdfktdlrfqssavmalqeace
aylvglfedtnlcaihakrvtimpkdiqlarrirger

SCOPe Domain Coordinates for d3azla_:

Click to download the PDB-style file with coordinates for d3azla_.
(The format of our PDB-style files is described here.)

Timeline for d3azla_: