| Class b: All beta proteins [48724] (104 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins) |
| Protein Immunoglobulin (variable domains of L and H chains) [48749] (195 species) |
| Species Fab BV04-01 (mouse), kappa L chain [48776] (2 PDB entries) |
| Domain d1nbvl1: 1nbv L:1-112 [19898] Other proteins in same PDB: d1nbvh2, d1nbvl2 |
PDB Entry: 1nbv (more details), 2 Å
SCOP Domain Sequences for d1nbvl1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nbvl1 b.1.1.1 (L:1-112) Immunoglobulin (variable domains of L and H chains) {Fab BV04-01 (mouse), kappa L chain}
dvvmtqtplslpvslgdqasiscrssqslvhsngntylhwylqkpgqspklliykvsnrf
sgvpdrfsgsgsgtdftlkisrveaedlgvyfcsqsthvpltfgagtklelk
Timeline for d1nbvl1: