SCOP 1.55: Domain d1nbvl1: 1nbv L:1-112

Lineage for d1nbvl1 (1nbv L:1-112)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species)

7. Species Fab BV04-01 (mouse), kappa L chain [48776] (2 PDB entries)

8. Domain d1nbvl1: 1nbv L:1-112 [19898]
   Other proteins in same PDB: d1nbvh2, d1nbvl2

Details for d1nbvl1

PDB Entry: 1nbv, 2 Å

PDB Description: an autoantibody to single-stranded dna: comparison of the three- dimensional structures of the unliganded fab and a deoxynucleotide- fab complex

SCOP Domain Sequences for d1nbvl1:

Sequence; same for both SEQRES and ATOM records:

>d1nbvl1 b.1.1.1 (L:1-112) Immunoglobulin (variable domains of L and H chains) {Fab BV04-01 (mouse), kappa L chain}
dvvmtqtplslpvslgdqasiscrssqslvhsngntylhwylqkpgqspklliykvsnrf
sgvpdrfsgsgsgtdftlkisrveaedlgvyfcsqsthvpltfgagtklelk

Timeline for d1nbvl1:

• d1nbvl1 appears in SCOP 1.57
  
• d1nbvl1 appears in the current release, SCOPe 2.08