Lineage for d3ay6d1 (3ay6 D:1-261)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2841375Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7

    has additional subdomain(s) that are not in the common domain
  6. 2842913Protein automated matches [190085] (59 species)
    not a true protein
  7. 2842992Species Bacillus megaterium [TaxId:1404] [195340] (5 PDB entries)
  8. 2843004Domain d3ay6d1: 3ay6 D:1-261 [198972]
    Other proteins in same PDB: d3ay6a2, d3ay6b2, d3ay6c2, d3ay6d2
    automated match to d3ay6a_
    complexed with bgc, cl, nai; mutant

Details for d3ay6d1

PDB Entry: 3ay6 (more details), 2.1 Å

PDB Description: crystal structure of bacillus megaterium glucose dehydrogenase 4 a258f mutant in complex with nadh and d-glucose
PDB Compounds: (D:) Glucose 1-dehydrogenase 4

SCOPe Domain Sequences for d3ay6d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ay6d1 c.2.1.2 (D:1-261) automated matches {Bacillus megaterium [TaxId: 1404]}
mytdlkdkvvvitggstglgramavrfgqeeakvvinyynneeealdakkeveeaggqai
ivqgdvtkeedvvnlvqtaikefgtldvminnagvenpvpshelsldnwnkvidtnltga
flgsreaikyfvendikgnvinmssvhemipwplfvhyaaskggmklmtetlaleyapkg
irvnnigpgamntpinaekfadpvqradvesmipmgyigkpeevaavaaflassqasyvt
gitlfadggmtkypsfqfgrg

SCOPe Domain Coordinates for d3ay6d1:

Click to download the PDB-style file with coordinates for d3ay6d1.
(The format of our PDB-style files is described here.)

Timeline for d3ay6d1: