Lineage for d3axmy_ (3axm Y:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2957669Fold d.73: RuBisCO, small subunit [55238] (1 superfamily)
    alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta
  4. 2957670Superfamily d.73.1: RuBisCO, small subunit [55239] (2 families) (S)
  5. 2957671Family d.73.1.1: RuBisCO, small subunit [55240] (2 proteins)
  6. 2957834Protein automated matches [190066] (7 species)
    not a true protein
  7. 2957908Species Oryza sativa [TaxId:39947] [195635] (2 PDB entries)
  8. 2957915Domain d3axmy_: 3axm Y: [198969]
    Other proteins in same PDB: d3axma1, d3axma2, d3axmb1, d3axmb2, d3axmc1, d3axmc2, d3axmd1, d3axmd2, d3axme1, d3axme2, d3axmf1, d3axmf2, d3axmg1, d3axmg2, d3axmh1, d3axmh2
    automated match to d3axmz_
    complexed with 6pg, mg

Details for d3axmy_

PDB Entry: 3axm (more details), 1.65 Å

PDB Description: Structure of rice Rubisco in complex with 6PG
PDB Compounds: (Y:) Ribulose bisphosphate carboxylase small chain, chloroplastic

SCOPe Domain Sequences for d3axmy_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3axmy_ d.73.1.1 (Y:) automated matches {Oryza sativa [TaxId: 39947]}
xmqvwpiegikkfetlsylppltvedllkqieyllrskwvpclefskvgfvyrenhrspg
yydgrywtmwklpmfgctdatqvlkeleeakkaypdafvriigfdnvrqvqlisfiaykp
pgc

SCOPe Domain Coordinates for d3axmy_:

Click to download the PDB-style file with coordinates for d3axmy_.
(The format of our PDB-style files is described here.)

Timeline for d3axmy_: