Lineage for d1mfdl1 (1mfd L:1-111)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 287096Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 287097Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (21 proteins)
  6. 288276Protein Immunoglobulin light chain lambda variable domain, VL-lambda [88534] (8 species)
    VL-lambda domains of human antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the human genome; mouse VL-lambda domains belong to a single germline family
  7. 288351Species Mouse (Mus musculus) [TaxId:10090] [88541] (25 PDB entries)
  8. 288359Domain d1mfdl1: 1mfd L:1-111 [19896]
    Other proteins in same PDB: d1mfdh1, d1mfdh2, d1mfdl2
    part of Fab SE155-4
    complexed with abe, gal, mma

Details for d1mfdl1

PDB Entry: 1mfd (more details), 2.1 Å

PDB Description: the solution structure of a trisaccharide-antibody complex: comparison of nmr measurements with a crystal structure

SCOP Domain Sequences for d1mfdl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mfdl1 b.1.1.1 (L:1-111) Immunoglobulin light chain lambda variable domain, VL-lambda {Mouse (Mus musculus)}
qavvtqesalttspgetvtltcrsstgtvtsgnhanwvqekpdhlftgligdtnnrapgv
parfsgsligdkaaltitgaqpedeaiyfcalwcnnhwifgggtkltvlgq

SCOP Domain Coordinates for d1mfdl1:

Click to download the PDB-style file with coordinates for d1mfdl1.
(The format of our PDB-style files is described here.)

Timeline for d1mfdl1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1mfdl2