SCOP 1.59: Domain d1mfch1: 1mfc H:251-367

Lineage for d1mfch1 (1mfc H:251-367)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (205 species)

7. Species Fab SE155-4 (mouse), lambda L chain [48775] (5 PDB entries)

8. Domain d1mfch1: 1mfc H:251-367 [19895]
   Other proteins in same PDB: d1mfch2, d1mfcl2

Details for d1mfch1

PDB Entry: 1mfc, 2.1 Å

PDB Description: high resolution structures of antibody fab fragment complexed with cell-surface oligosaccharide of pathogenic salmonella

SCOP Domain Sequences for d1mfch1:

Sequence; same for both SEQRES and ATOM records:

>d1mfch1 b.1.1.1 (H:251-367) Immunoglobulin (variable domains of L and H chains) {Fab SE155-4 (mouse), lambda L chain}
evqvqqsgtvlarpgasvkmsckasgytftnywmhwikqrpgqglewigaiypgnsatfy
nhkfraktkltavtstitaymelssltnedsavyyctrgghgyygdywgqgasltvs

Timeline for d1mfch1:

• d1mfch1 first appeared (with stable ids) in SCOP 1.55
  
• d1mfch1 appears in SCOP 1.57
  
• d1mfch1 appears in SCOP 1.61
  
• d1mfch1 appears in the current release, SCOPe 2.08