Lineage for d3axka2 (3axk A:151-462)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2088460Superfamily c.1.14: RuBisCo, C-terminal domain [51649] (2 families) (S)
    automatically mapped to Pfam PF00016
  5. 2088461Family c.1.14.1: RuBisCo, large subunit, C-terminal domain [51650] (2 protein domains)
    N-terminal domain is alpha+beta
  6. 2088462Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [51651] (12 species)
  7. 2088547Species Rice (Oryza sativa) [TaxId:4530] [117390] (3 PDB entries)
    Uniprot P12089
  8. 2088558Domain d3axka2: 3axk A:151-462 [198947]
    Other proteins in same PDB: d3axka1, d3axkb1, d3axks_, d3axkt_
    automated match to d1wdda1
    complexed with gol, mg, ndp

Details for d3axka2

PDB Entry: 3axk (more details), 1.9 Å

PDB Description: Structure of rice Rubisco in complex with NADP(H)
PDB Compounds: (A:) ribulose bisphosphate carboxylase large chain

SCOPe Domain Sequences for d3axka2:

Sequence, based on SEQRES records: (download)

>d3axka2 c.1.14.1 (A:151-462) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Rice (Oryza sativa) [TaxId: 4530]}
pphgiqverdklnkygrpllgctikpklglsaknygracyeclrggldftkddenvnsqp
fmrwrdrfvfcaeaiyksqaetgeikghylnatagtceemikravfarelgvpivmhdyl
tggftantslahycrdnglllhihramhavidrqknhgmhfrvlakalrmsggdhihagt
vvgklegeremtlgfvdllrddfiekdrargifftqdwvsmpgvipvasggihvwhmpal
teifgddsvlqfgggtlghpwgnapgaaanrvaleacvqarnegrdlaregneiirsack
wspelaaaceiw

Sequence, based on observed residues (ATOM records): (download)

>d3axka2 c.1.14.1 (A:151-462) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Rice (Oryza sativa) [TaxId: 4530]}
pphgiqverdklnkygrpllgctikpklglsaknygracyeclrggldftkddenvnsqp
fmrwrdrfvfcaeaiyksqaetgeikghylnatagtceemikravfarelgvpivmhdyl
tggftantslahycrdnglllhihramhavidrqknhgmhfrvlakalrmsggdhihagt
vveremtlgfvdllrddfiekdrargifftqdwvsmpgvipvasggihvwhmpalteifg
ddsvlqfgggtlghpwgnapgaaanrvaleacvqarnegrdlaregneiirsackwspel
aaaceiw

SCOPe Domain Coordinates for d3axka2:

Click to download the PDB-style file with coordinates for d3axka2.
(The format of our PDB-style files is described here.)

Timeline for d3axka2: