Lineage for d3aupc_ (3aup C:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2058814Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 2058815Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 2061036Family b.50.1.0: automated matches [191552] (1 protein)
    not a true family
  6. 2061037Protein automated matches [190954] (10 species)
    not a true protein
  7. 2061096Species Soybean (Glycine max) [TaxId:3847] [196358] (1 PDB entry)
  8. 2061099Domain d3aupc_: 3aup C: [198945]
    automated match to d3aupd_

Details for d3aupc_

PDB Entry: 3aup (more details), 1.91 Å

PDB Description: crystal structure of basic 7s globulin from soybean
PDB Compounds: (C:) Basic 7S globulin

SCOPe Domain Sequences for d3aupc_:

Sequence, based on SEQRES records: (download)

>d3aupc_ b.50.1.0 (C:) automated matches {Soybean (Glycine max) [TaxId: 3847]}
pinlvvlpvqndgstglhwanlqkrtplmqvpvlvdlngnhlwvnceqqyssktyqapfc
hstqcsranthqclscpaasrpgchkntcglmstnpitqqtglgelgedvlaihatqgst
qqlgplvtvpqflfscapsflvqkglprntqgvaglghapislpnqlashfglqrqfttc
lsryptskgaiifgdapnnmrqfqnqdifhdlaftpltitlqgeynvrvnsirinqhsvf
plnkisstivgstsggtmiststphmvlqqsvyqaftqvfaqqlpkqaqvksvapfglcf
nsnkinaypsvdlvmdkpngpvwrisgedlmvqaqpgvtclgvmnggmqpraeitlgarq
leenlvvfdlarsrvgfstsslhshgvkcadlfn

Sequence, based on observed residues (ATOM records): (download)

>d3aupc_ b.50.1.0 (C:) automated matches {Soybean (Glycine max) [TaxId: 3847]}
pinlvvlpvqndgstglhwanlqkrtplmqvpvlvdlngnhlwvnceqqyssktyqapfc
hstqcsranthqclscpaasrpgchkntcglmstnpitqqtglgelgedvlaihatlgpl
vtvpqflfscapsflvqkglprntqgvaglghapislpnqlashfglqrqfttclsrypt
skgaiifgdapnnmfhdlaftpltitlqgeynvrvnsirinqhsvfplstivgstsggtm
iststphmvlqqsvyqaftqvfaqqlpkqaqvksvapfglcfnsnkinaypsvdlvmdkp
ngpvwrisgedlmvqaqpgvtclgvmnggmqpraeitlgarqleenlvvfdlarsrvgfs
tsslhscadlfn

SCOPe Domain Coordinates for d3aupc_:

Click to download the PDB-style file with coordinates for d3aupc_.
(The format of our PDB-style files is described here.)

Timeline for d3aupc_: