Lineage for d3auje_ (3auj E:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1371340Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest
  4. 1371489Superfamily c.51.3: B12-dependent dehydatase associated subunit [52968] (2 families) (S)
  5. 1371490Family c.51.3.1: Diol dehydratase, beta subunit [52969] (1 protein)
    contains additional structures in the C-terminal extension
  6. 1371491Protein Diol dehydratase, beta subunit [52970] (2 species)
  7. 1371492Species Klebsiella oxytoca [TaxId:571] [52971] (8 PDB entries)
  8. 1371504Domain d3auje_: 3auj E: [198940]
    Other proteins in same PDB: d3auja_, d3aujg_, d3aujl_, d3aujm_
    automated match to d1diob_
    complexed with b12, ca, gol, po4

Details for d3auje_

PDB Entry: 3auj (more details), 2.1 Å

PDB Description: Structure of diol dehydratase complexed with glycerol
PDB Compounds: (E:) diol dehydrase beta subunit

SCOPe Domain Sequences for d3auje_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3auje_ c.51.3.1 (E:) Diol dehydratase, beta subunit {Klebsiella oxytoca [TaxId: 571]}
dgfltevgearqgtqqdeviiavgpafglaqtvnivgiphksilreviagieeegikarv
ircfkssdvafvavegnrlsgsgisigiqskgttvihqqglpplsnlelfpqaplltlet
yrqigknaaryakrespqpvptlndqmarpkyqaksailhiketkyvvtgknpqelrval

SCOPe Domain Coordinates for d3auje_:

Click to download the PDB-style file with coordinates for d3auje_.
(The format of our PDB-style files is described here.)

Timeline for d3auje_: