SCOP 1.71: Domain d1mfcl1: 1mfc L:1-111

Lineage for d1mfcl1 (1mfc L:1-111)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (28 proteins)

6. Protein Immunoglobulin light chain lambda variable domain, VL-lambda [88534] (9 species)
   VL-lambda domains of human antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the human genome; mouse VL-lambda domains belong to a single germline family

7. Species Mouse (Mus musculus) [TaxId:10090] [88541] (33 PDB entries)

8. Domain d1mfcl1: 1mfc L:1-111 [19894]
   Other proteins in same PDB: d1mfch1, d1mfch2, d1mfcl2
   part of Fab SE155-4
   complexed with abe, gal, man, ram

Details for d1mfcl1

PDB Entry: 1mfc, 2.1 Å

PDB Description: high resolution structures of antibody fab fragment complexed with cell-surface oligosaccharide of pathogenic salmonella

SCOP Domain Sequences for d1mfcl1:

Sequence; same for both SEQRES and ATOM records:

>d1mfcl1 b.1.1.1 (L:1-111) Immunoglobulin light chain lambda variable domain, VL-lambda {Mouse (Mus musculus)}
qavvtqesalttspgetvtltcrsstgtvtsgnhanwvqekpdhlftgligdtnnrapgv
parfsgsligdkaaltitgaqpedeaiyfcalwcnnhwifgggtkltvlgq

Timeline for d1mfcl1:

• d1mfcl1 first appeared (with stable ids) in SCOP 1.55
  
• d1mfcl1 appears in SCOP 1.69
  
• d1mfcl1 appears in SCOP 1.73
  
• d1mfcl1 appears in the current release, SCOPe 2.08