Lineage for d1mfeh1 (1mfe H:251-367)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 51642Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 51698Protein Immunoglobulin (variable domains of L and H chains) [48749] (195 species)
  7. 52539Species Fab SE155-4 (mouse), lambda L chain [48775] (5 PDB entries)
  8. 52546Domain d1mfeh1: 1mfe H:251-367 [19893]
    Other proteins in same PDB: d1mfeh2, d1mfel2

Details for d1mfeh1

PDB Entry: 1mfe (more details), 2 Å

PDB Description: recognition of a cell-surface oligo-saccharide of pathogenic salmonella by an antibody fab fragment

SCOP Domain Sequences for d1mfeh1:

Sequence, based on SEQRES records: (download)

>d1mfeh1 b.1.1.1 (H:251-367) Immunoglobulin (variable domains of L and H chains) {Fab SE155-4 (mouse), lambda L chain}
evqvqqsgtvlarpgasvkmsckasgytftnywmhwikqrpgqglewigaiypgnsatfy
nhkfraktkltavtstitaymelssltnedsavyyctrgghgyygdywgqgasltvs

Sequence, based on observed residues (ATOM records): (download)

>d1mfeh1 b.1.1.1 (H:251-367) Immunoglobulin (variable domains of L and H chains) {Fab SE155-4 (mouse), lambda L chain}
evqvqqsgtvlarpgasvkmsckasgytftnywmhwikqrpgglewigaiypgnsatfyn
hkfraktkltavtstitaymelssltnedsavyyctrgghgyygdywgqgasltvs

SCOP Domain Coordinates for d1mfeh1:

Click to download the PDB-style file with coordinates for d1mfeh1.
(The format of our PDB-style files is described here.)

Timeline for d1mfeh1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1mfeh2