SCOPe 2.05: Domain d3asob2: 3aso B:91-227

Lineage for d3asob2 (3aso B:91-227)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.2: Periplasmic domain of cytochrome c oxidase subunit II [49541] (3 proteins)

6. Protein Cytochrome c oxidase [49544] (4 species)

7. Species Cow (Bos taurus) [TaxId:9913] [49545] (26 PDB entries)

8. Domain d3asob2: 3aso B:91-227 [198926]
   Other proteins in same PDB: d3asoa_, d3asob1, d3asoc_, d3asod_, d3asoe_, d3asof_, d3asog_, d3asoh_, d3asoi_, d3asoj_, d3asok_, d3asol_, d3asom_, d3ason_, d3asoo1, d3asop_, d3asoq_, d3asor_, d3asos_, d3asot_, d3asou_, d3asov_, d3asow_, d3asox_, d3asoy_, d3asoz_
   automated match to d1v54b1
   complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, unx, zn

Details for d3asob2

PDB Entry: 3aso, 2.3 Å

PDB Description: Bovine heart cytochrome C oxidase in the fully oxidized state measured at 0.9 angstrom wavelength

PDB Compounds: (B:) Cytochrome c oxidase subunit 2

SCOPe Domain Sequences for d3asob2:

Sequence; same for both SEQRES and ATOM records:

>d3asob2 b.6.1.2 (B:91-227) Cytochrome c oxidase {Cow (Bos taurus) [TaxId: 9913]}
nnpsltvktmghqwywsyeytdyedlsfdsymiptselkpgelrllevdnrvvlpmemti
rmlvssedvlhswavpslglktdaipgrlnqttlmssrpglyygqcseicgsnhsfmpiv
lelvplkyfekwsasml

Timeline for d3asob2:

• d3asob2 first appeared in SCOPe 2.03
  
• d3asob2 appears in SCOPe 2.04
  
• d3asob2 appears in SCOPe 2.06
  
• d3asob2 appears in the current release, SCOPe 2.08