Lineage for d3asob1 (3aso B:1-90)

  1. Root: SCOPe 2.05
  2. 1955192Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1956758Fold f.17: Transmembrane helix hairpin [81334] (6 superfamilies)
    two antiparallel transmembrane helices
  4. 1956780Superfamily f.17.2: Cytochrome c oxidase subunit II-like, transmembrane region [81464] (2 families) (S)
  5. 1956781Family f.17.2.1: Cytochrome c oxidase subunit II-like, transmembrane region [81463] (5 proteins)
  6. 1956826Protein Mitochondrial cytochrome c oxidase, subunit II [81455] (1 species)
  7. 1956827Species Cow (Bos taurus) [TaxId:9913] [81454] (26 PDB entries)
  8. 1956854Domain d3asob1: 3aso B:1-90 [198925]
    Other proteins in same PDB: d3asoa_, d3asob2, d3asoc_, d3asod_, d3asoe_, d3asof_, d3asog_, d3asoh_, d3asoi_, d3asoj_, d3asok_, d3asol_, d3asom_, d3ason_, d3asoo2, d3asop_, d3asoq_, d3asor_, d3asos_, d3asot_, d3asou_, d3asov_, d3asow_, d3asox_, d3asoy_, d3asoz_
    automated match to d1v54b2
    complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, unx, zn

Details for d3asob1

PDB Entry: 3aso (more details), 2.3 Å

PDB Description: Bovine heart cytochrome C oxidase in the fully oxidized state measured at 0.9 angstrom wavelength
PDB Compounds: (B:) Cytochrome c oxidase subunit 2

SCOPe Domain Sequences for d3asob1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3asob1 f.17.2.1 (B:1-90) Mitochondrial cytochrome c oxidase, subunit II {Cow (Bos taurus) [TaxId: 9913]}
maypmqlgfqdatspimeellhfhdhtlmivflisslvlyiislmlttklthtstmdaqe
vetiwtilpaiililialpslrilymmdei

SCOPe Domain Coordinates for d3asob1:

Click to download the PDB-style file with coordinates for d3asob1.
(The format of our PDB-style files is described here.)

Timeline for d3asob1: