| Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
| Fold f.24: Cytochrome c oxidase subunit I-like [81443] (1 superfamily) 12 transmembrane helices in an approximate threefold rotational symmetric arrangement |
Superfamily f.24.1: Cytochrome c oxidase subunit I-like [81442] (1 family) ![]() |
| Family f.24.1.1: Cytochrome c oxidase subunit I-like [81441] (5 proteins) the largest and best conserved subunit, contains two heme groups, low spin heme a and high spin heme a3 |
| Protein Mitochondrial cytochrome c oxidase, subunit I [81433] (1 species) |
| Species Cow (Bos taurus) [TaxId:9913] [81432] (10 PDB entries) |
| Domain d3asoa_: 3aso A: [198924] Other proteins in same PDB: d3asob1, d3asob2, d3asoc_, d3asod_, d3asoe_, d3asof_, d3asog_, d3asoh_, d3asoi_, d3asoj_, d3asok_, d3asol_, d3asom_, d3ason_, d3asoo1, d3asoo2, d3asop_, d3asoq_, d3asor_, d3asos_, d3asot_, d3asou_, d3asov_, d3asow_, d3asox_, d3asoy_, d3asoz_ automated match to d1v54a_ complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, unx, zn |
PDB Entry: 3aso (more details), 2.3 Å
SCOPe Domain Sequences for d3asoa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3asoa_ f.24.1.1 (A:) Mitochondrial cytochrome c oxidase, subunit I {Cow (Bos taurus) [TaxId: 9913]}
mfinrwlfstnhkdigtlyllfgawagmvgtalslliraelgqpgtllgddqiynvvvta
hafvmiffmvmpimiggfgnwlvplmigapdmafprmnnmsfwllppsfllllassmvea
gagtgwtvypplagnlahagasvdltifslhlagvssilgainfittiinmkppamsqyq
tplfvwsvmitavllllslpvlaagitmlltdrnlnttffdpagggdpilyqhlfwffgh
pevyililpgfgmishivtyysgkkepfgymgmvwammsigflgfivwahhmftvgmdvd
trayftsatmiiaiptgvkvfswlatlhggnikwspammwalgfiflftvggltgivlan
ssldivlhdtyyvvahfhyvlsmgavfaimggfvhwfplfsgytlndtwakihfaimfvg
vnmtffpqhflglsgmprrysdypdaytmwntissmgsfisltavmlmvfiiweafaskr
evltvdltttnlewlngcpppyhtfeeptyvnlk
Timeline for d3asoa_:
View in 3DDomains from other chains: (mouse over for more information) d3asob1, d3asob2, d3asoc_, d3asod_, d3asoe_, d3asof_, d3asog_, d3asoh_, d3asoi_, d3asoj_, d3asok_, d3asol_, d3asom_, d3ason_, d3asoo1, d3asoo2, d3asop_, d3asoq_, d3asor_, d3asos_, d3asot_, d3asou_, d3asov_, d3asow_, d3asox_, d3asoy_, d3asoz_ |