SCOPe 2.04: Domain d3arfd1: 3arf D:4-118

Lineage for d3arfd1 (3arf D:4-118)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (19 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (388 PDB entries)

8. Domain d3arfd1: 3arf D:4-118 [198922]
   Other proteins in same PDB: d3arfa1, d3arfa2, d3arfb_, d3arfc2, d3arfd2
   automated match to d1ktke1
   complexed with db3

Details for d3arfd1

PDB Entry: 3arf, 2.9 Å

PDB Description: ternary crystal structure of the mouse nkt tcr-cd1d-c20:2

PDB Compounds: (D:) Vbeta8.2

SCOPe Domain Sequences for d3arfd1:

Sequence, based on SEQRES records:

>d3arfd1 b.1.1.0 (D:4-118) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
vtqsprnkvavtggkvtlscnqtnnhnnmywyrqdtghglrlihysygagstekgdipdg
ykasrpsqenfslilelatpsqtsvyfcasgdaggnyaeqffgpgtrltvle

Sequence, based on observed residues (ATOM records):

>d3arfd1 b.1.1.0 (D:4-118) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
vtqsprnkvavtggkvtlscnqtnnhnnmywyrqdtghglrlihysygagstekgdipdg
ykasrpsqenfslilelatpsqtsvyfcasgdeqffgpgtrltvle

Timeline for d3arfd1:

• d3arfd1 first appeared in SCOPe 2.03
  
• d3arfd1 appears in SCOPe 2.05
  
• d3arfd1 appears in the current release, SCOPe 2.08