| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
| Protein automated matches [190374] (15 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries) |
| Domain d3arfc2: 3arf C:118-207 [198921] Other proteins in same PDB: d3arfa1, d3arfa2, d3arfa3, d3arfb_, d3arfc1, d3arfd1 automated match to d1qrnd2 complexed with db3 |
PDB Entry: 3arf (more details), 2.9 Å
SCOPe Domain Sequences for d3arfc2:
Sequence, based on SEQRES records: (download)
>d3arfc2 b.1.1.2 (C:118-207) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtffpsp
>d3arfc2 b.1.1.2 (C:118-207) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnkdfacanafnnsiipedtffpsp
Timeline for d3arfc2: