Lineage for d3arfc2 (3arf C:118-207)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2749887Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)
  8. 2751565Domain d3arfc2: 3arf C:118-207 [198921]
    Other proteins in same PDB: d3arfa1, d3arfa2, d3arfa3, d3arfb_, d3arfc1, d3arfd1
    automated match to d1qrnd2
    complexed with db3

Details for d3arfc2

PDB Entry: 3arf (more details), 2.9 Å

PDB Description: ternary crystal structure of the mouse nkt tcr-cd1d-c20:2
PDB Compounds: (C:) NKT Valpha14-Jalpha18,NKT Valpha14-Jalpha18

SCOPe Domain Sequences for d3arfc2:

Sequence, based on SEQRES records: (download)

>d3arfc2 b.1.1.2 (C:118-207) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtffpsp

Sequence, based on observed residues (ATOM records): (download)

>d3arfc2 b.1.1.2 (C:118-207) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnkdfacanafnnsiipedtffpsp

SCOPe Domain Coordinates for d3arfc2:

Click to download the PDB-style file with coordinates for d3arfc2.
(The format of our PDB-style files is described here.)

Timeline for d3arfc2: