Lineage for d3arfc2 (3arf C:118-207)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2348364Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 protein domains)
  6. 2352435Protein automated matches [190374] (14 species)
    not a true protein
  7. 2353824Species Mouse (Mus musculus) [TaxId:10090] [224855] (518 PDB entries)
  8. 2354475Domain d3arfc2: 3arf C:118-207 [198921]
    Other proteins in same PDB: d3arfa1, d3arfa2, d3arfa3, d3arfb_, d3arfc1, d3arfd1
    automated match to d1qrnd2
    complexed with db3

Details for d3arfc2

PDB Entry: 3arf (more details), 2.9 Å

PDB Description: Ternary crystal structure of the mouse NKT TCR-CD1d-C20:2
PDB Compounds: (C:) NKT Valpha14-Jalpha18

SCOPe Domain Sequences for d3arfc2:

Sequence, based on SEQRES records: (download)

>d3arfc2 b.1.1.2 (C:118-207) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtffpsp

Sequence, based on observed residues (ATOM records): (download)

>d3arfc2 b.1.1.2 (C:118-207) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnkdfacanafnnsiipedtffpsp

SCOPe Domain Coordinates for d3arfc2:

Click to download the PDB-style file with coordinates for d3arfc2.
(The format of our PDB-style files is described here.)

Timeline for d3arfc2: