SCOP 1.61: Domain d1mfel1: 1mfe L:1-111

Lineage for d1mfel1 (1mfe L:1-111)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (222 species)

7. Species Fab SE155-4 (mouse), lambda L chain [48775] (5 PDB entries)

8. Domain d1mfel1: 1mfe L:1-111 [19892]
   Other proteins in same PDB: d1mfeh2, d1mfel2

Details for d1mfel1

PDB Entry: 1mfe, 2 Å

PDB Description: recognition of a cell-surface oligo-saccharide of pathogenic salmonella by an antibody fab fragment

SCOP Domain Sequences for d1mfel1:

Sequence; same for both SEQRES and ATOM records:

>d1mfel1 b.1.1.1 (L:1-111) Immunoglobulin (variable domains of L and H chains) {Fab SE155-4 (mouse), lambda L chain}
eavvtqesalttspgetvtltcrsstgtvtsgnhanwvqekpdhlftgligdtnnrapgv
parfsgsligdkaaltitgaqpedeaiyfcalwcnnhwifgggtkltvlgq

Timeline for d1mfel1:

• d1mfel1 first appeared (with stable ids) in SCOP 1.55
  
• d1mfel1 appears in SCOP 1.59
  
• d1mfel1 appears in SCOP 1.63
  
• d1mfel1 appears in the current release, SCOPe 2.08