Lineage for d1mfel1 (1mfe L:1-111)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2741614Protein Immunoglobulin light chain lambda variable domain, VL-lambda [88534] (9 species)
    VL-lambda domains of human antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the human genome; mouse VL-lambda domains belong to a single germline family
  7. 2741706Species Mouse (Mus musculus) [TaxId:10090] [88541] (36 PDB entries)
  8. 2741713Domain d1mfel1: 1mfe L:1-111 [19892]
    Other proteins in same PDB: d1mfeh1, d1mfeh2, d1mfel2
    part of Fab SE155-4

Details for d1mfel1

PDB Entry: 1mfe (more details), 2 Å

PDB Description: recognition of a cell-surface oligo-saccharide of pathogenic salmonella by an antibody fab fragment
PDB Compounds: (L:) igg1-lambda se155-4 fab (light chain)

SCOPe Domain Sequences for d1mfel1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mfel1 b.1.1.1 (L:1-111) Immunoglobulin light chain lambda variable domain, VL-lambda {Mouse (Mus musculus) [TaxId: 10090]}
eavvtqesalttspgetvtltcrsstgtvtsgnhanwvqekpdhlftgligdtnnrapgv
parfsgsligdkaaltitgaqpedeaiyfcalwcnnhwifgggtkltvlgq

SCOPe Domain Coordinates for d1mfel1:

Click to download the PDB-style file with coordinates for d1mfel1.
(The format of our PDB-style files is described here.)

Timeline for d1mfel1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1mfel2