![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein CD1, alpha-3 domain [88615] (5 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [88616] (11 PDB entries) |
![]() | Domain d3arfa2: 3arf A:186-279 [198919] Other proteins in same PDB: d3arfa1, d3arfa3, d3arfb_, d3arfc1, d3arfc2, d3arfd1, d3arfd2 automated match to d1gzqa1 complexed with db3 |
PDB Entry: 3arf (more details), 2.9 Å
SCOPe Domain Sequences for d3arfa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3arfa2 b.1.1.2 (A:186-279) CD1, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]} qekpvawlssvpssahghrqlvchvsgfypkpvwvmwmrgdqeqqgthrgdflpnadetw ylqatldveageeaglacrvkhsslggqdiilyw
Timeline for d3arfa2: