Lineage for d3ared2 (3are D:119-247)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2749887Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)
  8. 2751427Domain d3ared2: 3are D:119-247 [198917]
    Other proteins in same PDB: d3area1, d3area2, d3area3, d3areb_, d3arec1, d3ared1
    automated match to d1ktke2
    complexed with 4gh, nag, peg

Details for d3ared2

PDB Entry: 3are (more details), 2.8 Å

PDB Description: ternary crystal structure of the mouse nkt tcr-cd1d-4'deoxy-alpha- galactosylceramide
PDB Compounds: (D:) Vbeta8.2,Vbeta8.2

SCOPe Domain Sequences for d3ared2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ared2 b.1.1.2 (D:119-247) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpq
plkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqiv
saeawgrad

SCOPe Domain Coordinates for d3ared2:

Click to download the PDB-style file with coordinates for d3ared2.
(The format of our PDB-style files is described here.)

Timeline for d3ared2: