SCOPe 2.08: Domain d3ared1: 3are D:3-118

Lineage for d3ared1 (3are D:3-118)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)

8. Domain d3ared1: 3are D:3-118 [198916]
   Other proteins in same PDB: d3area1, d3area2, d3area3, d3areb_, d3arec2, d3ared2
   automated match to d1ktke1
   complexed with 4gh, nag, peg

Details for d3ared1

PDB Entry: 3are, 2.8 Å

PDB Description: ternary crystal structure of the mouse nkt tcr-cd1d-4'deoxy-alpha- galactosylceramide

PDB Compounds: (D:) Vbeta8.2,Vbeta8.2

SCOPe Domain Sequences for d3ared1:

Sequence, based on SEQRES records:

>d3ared1 b.1.1.0 (D:3-118) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
avtqsprnkvavtggkvtlscnqtnnhnnmywyrqdtghglrlihysygagstekgdipd
gykasrpsqenfslilelatpsqtsvyfcasgdaggnyaeqffgpgtrltvle

Sequence, based on observed residues (ATOM records):

>d3ared1 b.1.1.0 (D:3-118) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
avtqsprnkvavtggkvtlscnqtnnhnnmywyrqdtghglrlihysygagstekgdipd
gykasrpsqenfslilelatpsqtsvyfcasgdaaeqffgpgtrltvle

Timeline for d3ared1:

• d3ared1 first appeared in SCOPe 2.03
  
• d3ared1 appears in SCOPe 2.07