Lineage for d3ared1 (3are D:3-118)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2026644Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2026645Protein automated matches [190740] (27 species)
    not a true protein
  7. 2028399Species Mouse (Mus musculus) [TaxId:10090] [188198] (569 PDB entries)
  8. 2029092Domain d3ared1: 3are D:3-118 [198916]
    Other proteins in same PDB: d3area1, d3area2, d3area3, d3areb_, d3arec2, d3ared2
    automated match to d1ktke1
    complexed with 4gh, nag, peg

Details for d3ared1

PDB Entry: 3are (more details), 2.8 Å

PDB Description: Ternary crystal structure of the mouse NKT TCR-CD1d-4'deoxy-alpha-galactosylceramide
PDB Compounds: (D:) Vbeta8.2

SCOPe Domain Sequences for d3ared1:

Sequence, based on SEQRES records: (download)

>d3ared1 b.1.1.0 (D:3-118) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
avtqsprnkvavtggkvtlscnqtnnhnnmywyrqdtghglrlihysygagstekgdipd
gykasrpsqenfslilelatpsqtsvyfcasgdaggnyaeqffgpgtrltvle

Sequence, based on observed residues (ATOM records): (download)

>d3ared1 b.1.1.0 (D:3-118) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
avtqsprnkvavtggkvtlscnqtnnhnnmywyrqdtghglrlihysygagstekgdipd
gykasrpsqenfslilelatpsqtsvyfcasgdaaeqffgpgtrltvle

SCOPe Domain Coordinates for d3ared1:

Click to download the PDB-style file with coordinates for d3ared1.
(The format of our PDB-style files is described here.)

Timeline for d3ared1: