SCOPe 2.03: Domain d3arec2: 3are C:118-207

Lineage for d3arec2 (3are C:118-207)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (12 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (237 PDB entries)

8. Domain d3arec2: 3are C:118-207 [198915]
   Other proteins in same PDB: d3area1, d3area2, d3areb_, d3arec1, d3ared1
   automated match to d1qrnd2
   complexed with 4gh, nag, peg

Details for d3arec2

PDB Entry: 3are, 2.8 Å

PDB Description: ternary crystal structure of the mouse nkt tcr-cd1d-4'deoxy-alpha- galactosylceramide

PDB Compounds: (C:) NKT Valpha14-Jalpha18

SCOPe Domain Sequences for d3arec2:

Sequence, based on SEQRES records:

>d3arec2 b.1.1.2 (C:118-207) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtffpsp

Sequence, based on observed residues (ATOM records):

>d3arec2 b.1.1.2 (C:118-207) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnkdfacanafnnsiipedtffpsp

Timeline for d3arec2:

• d3arec2 is new in SCOPe 2.03-stable
  
• d3arec2 appears in SCOPe 2.04
  
• d3arec2 appears in the current release, SCOPe 2.07