![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein CD1, alpha-3 domain [88615] (5 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [88616] (11 PDB entries) |
![]() | Domain d3area2: 3are A:186-300 [198913] Other proteins in same PDB: d3area1, d3areb_, d3arec1, d3arec2, d3ared1, d3ared2 automated match to d1gzqa1 complexed with 4gh, nag, peg |
PDB Entry: 3are (more details), 2.8 Å
SCOPe Domain Sequences for d3area2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3area2 b.1.1.2 (A:186-300) CD1, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]} qekpvawlssvpssahghrqlvchvsgfypkpvwvmwmrgdqeqqgthrgdflpnadetw ylqatldveageeaglacrvkhsslggqdiilywgslhhildaqkmvwnhrhhhh
Timeline for d3area2: