Lineage for d3area1 (3are A:7-185)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2163004Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2163005Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2163006Family d.19.1.1: MHC antigen-recognition domain [54453] (13 protein domains)
  6. 2163007Protein CD1, alpha-1 and alpha-2 domains [54456] (5 species)
    Class I MHC-related
  7. 2163048Species Mouse (Mus musculus) [TaxId:10090] [54457] (25 PDB entries)
  8. 2163069Domain d3area1: 3are A:7-185 [198912]
    Other proteins in same PDB: d3area2, d3area3, d3areb_, d3arec1, d3arec2, d3ared1, d3ared2
    automated match to d1gzpa2
    complexed with 4gh, nag, peg

Details for d3area1

PDB Entry: 3are (more details), 2.8 Å

PDB Description: Ternary crystal structure of the mouse NKT TCR-CD1d-4'deoxy-alpha-galactosylceramide
PDB Compounds: (A:) Antigen-presenting glycoprotein CD1d1

SCOPe Domain Sequences for d3area1:

Sequence, based on SEQRES records: (download)

>d3area1 d.19.1.1 (A:7-185) CD1, alpha-1 and alpha-2 domains {Mouse (Mus musculus) [TaxId: 10090]}
nytfrclqmssfanrswsrtdsvvwlgdlqthrwsndsatisftkpwsqgklsnqqwekl
qhmfqvyrvsftrdiqelvkmmspkedypieiqlsagcemypgnasesflhvafqgkyvv
rfwgtswqtvpgapswldlpikvlnadqgtsatvqmllndtcplfvrglleagksdlek

Sequence, based on observed residues (ATOM records): (download)

>d3area1 d.19.1.1 (A:7-185) CD1, alpha-1 and alpha-2 domains {Mouse (Mus musculus) [TaxId: 10090]}
nytfrclqmssfanrswsrtdsvvwlgdlqthrwsndsatisftkpwsqgklsnqqwekl
qhmfqvyrvsftrdiqelvkmmskedypieiqlsagcemygnasesflhvafqgkyvvrf
wgtswqtvpgapswldlpikvlnadqgtsatvqmllndtcplfvrglleagksdlek

SCOPe Domain Coordinates for d3area1:

Click to download the PDB-style file with coordinates for d3area1.
(The format of our PDB-style files is described here.)

Timeline for d3area1: