SCOPe 2.08: Domain d3arbd2: 3arb D:119-247

Lineage for d3arbd2 (3arb D:119-247)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d3arbd2: 3arb D:119-247 [198909]
   Other proteins in same PDB: d3arba1, d3arba2, d3arba3, d3arbb_, d3arbc1, d3arbd1
   automated match to d1ktke2
   complexed with d12, fee, nag, peg

Details for d3arbd2

PDB Entry: 3arb, 2.7 Å

PDB Description: ternary crystal structure of the nkt tcr-cd1d-alpha-galactosylceramide analogue-och

PDB Compounds: (D:) NKT Vbeta8.2,NKT Vbeta8.2

SCOPe Domain Sequences for d3arbd2:

Sequence; same for both SEQRES and ATOM records:

>d3arbd2 b.1.1.2 (D:119-247) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpq
plkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqiv
saeawgrad

Timeline for d3arbd2:

• d3arbd2 first appeared in SCOPe 2.03
  
• d3arbd2 appears in SCOPe 2.07