SCOPe 2.07: Domain d3alta_: 3alt A:

Lineage for d3alta_ (3alt A:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (9 families)

5. Family d.169.1.0: automated matches [191331] (1 protein)
   not a true family

6. Protein automated matches [190159] (20 species)
   not a true protein

7. Species Cucumaria echinata [TaxId:40245] [189610] (3 PDB entries)

8. Domain d3alta_: 3alt A: [198900]
   automated match to d3alud_
   complexed with ca, mlb

Details for d3alta_

PDB Entry: 3alt, 2.5 Å

PDB Description: crystal structure of cel-iv complexed with melibiose

PDB Compounds: (A:) Lectin CEL-IV, C-type

SCOPe Domain Sequences for d3alta_:

Sequence; same for both SEQRES and ATOM records:

>d3alta_ d.169.1.0 (A:) automated matches {Cucumaria echinata [TaxId: 40245]}
ltscpplwtgfngkcfrlfhnhlnfdnaenacrqfglascsgdelatghlasihsaesqa
fltelvktslpdlitggwapqvyigmkvgstnsdqtwtdgssvdydgwvsgepnngpnsr
gaiaagdysrgfwadvysnnnfkyicqlpcvhytle

Timeline for d3alta_:

• d3alta_ first appeared in SCOPe 2.03
  
• d3alta_ appears in SCOPe 2.06
  
• d3alta_ appears in the current release, SCOPe 2.08