Lineage for d3alta_ (3alt A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2558905Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 2558906Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 2559681Family d.169.1.0: automated matches [191331] (1 protein)
    not a true family
  6. 2559682Protein automated matches [190159] (19 species)
    not a true protein
  7. 2559704Species Cucumaria echinata [TaxId:40245] [189610] (3 PDB entries)
  8. 2559709Domain d3alta_: 3alt A: [198900]
    automated match to d3alud_
    complexed with ca, mlb

Details for d3alta_

PDB Entry: 3alt (more details), 2.5 Å

PDB Description: crystal structure of cel-iv complexed with melibiose
PDB Compounds: (A:) Lectin CEL-IV, C-type

SCOPe Domain Sequences for d3alta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3alta_ d.169.1.0 (A:) automated matches {Cucumaria echinata [TaxId: 40245]}
ltscpplwtgfngkcfrlfhnhlnfdnaenacrqfglascsgdelatghlasihsaesqa
fltelvktslpdlitggwapqvyigmkvgstnsdqtwtdgssvdydgwvsgepnngpnsr
gaiaagdysrgfwadvysnnnfkyicqlpcvhytle

SCOPe Domain Coordinates for d3alta_:

Click to download the PDB-style file with coordinates for d3alta_.
(The format of our PDB-style files is described here.)

Timeline for d3alta_: